Primary Antibodies

Jump to Filters
View as table Download
SLC17A5 Rabbit Polyclonal Antibody
TA333879

USD 375.00

5 Days

Rabbit Polyclonal Anti-SLC17A5 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC17A5 Antibody: synthetic peptide directed towards the N terminal of human SLC17A5. Synthetic peptide located within the following region: LFTPIAADLGVGPLIVLRALEGLGEGVTFPAMHAMWSSWAPPLERSKLLS