Primary Antibodies

Jump to Filters
View as table Download
KLHL25 Rabbit Polyclonal Antibody
TA337249

USD 310.00

5 Days

Rabbit Polyclonal Anti-KLHL25 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KLHL25 antibody: synthetic peptide directed towards the N terminal of human KLHL25. Synthetic peptide located within the following region: RLYEFSWRMCLVHFETVRQSEDFNSLSKDTLLDLISSDELETEDERVVFE