Anti-SNAI1 (SNAIL) mouse monoclonal antibody, clone OTI5E12 (formerly 5E12)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-SNAI1 (SNAIL) mouse monoclonal antibody, clone OTI5E12 (formerly 5E12)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-SNAI1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human SNAI1 |
Rabbit anti-Snail Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human Snail |
Rabbit Polyclonal Anti-SNAI1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SNAI1 Antibody: synthetic peptide directed towards the N terminal of human SNAI1. Synthetic peptide located within the following region: MPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEIL |
Carrier-free (BSA/glycerol-free) SNAI1 mouse monoclonal antibody, clone OTI5E12 (formerly 5E12)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-SNAI1 (SNAIL) mouse monoclonal antibody, clone OTI5E12 (formerly 5E12), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
Anti-SNAI1 (SNAIL) mouse monoclonal antibody, clone OTI5E12 (formerly 5E12), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Anti-SNAI1 (SNAIL) mouse monoclonal antibody, clone OTI5E12 (formerly 5E12)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |