Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-RAB22A Antibody - middle region

Applications IHC, WB
Reactivities Human, Murine
Conjugation Unconjugated
Immunogen The immunogen for anti-RAB22A antibody: synthetic peptide directed towards the middle region of human RAB22A. Synthetic peptide located within the following region: IFVETSAKNAININELFIEISRRIPSTDANLPSGGKGFKLRRQPSEPKRS

Anti-RAB22A rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 128-140 amino acids of Human Ras-related protein Rab-22A

Anti-RAB22A rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 128-140 amino acids of Human Ras-related protein Rab-22A