Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-FGF2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-FGF2 antibody: synthetic peptide directed towards the middle region of human FGF2. Synthetic peptide located within the following region: RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

FGF2 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen A peptide mapping near the N-terminal of Human FGF2, identical to the related Rat and Mouse sequence

Anti-Human FGF-basic Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human FGF-basic (154 a.a.)

FGF2 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 37-66 amino acids from the Central region of human FGF2

Carrier-free (BSA/glycerol-free) BFGF mouse monoclonal antibody, clone OTI3D9 (formerly 3D9)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-FGF2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 215-229 amino acids of Human Fibroblast growth factor 2

bFGF (FGF2) mouse monoclonal antibody, clone OTI3D9 (formerly 3D9)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

bFGF (FGF2) mouse monoclonal antibody, clone OTI3D9 (formerly 3D9), HRP conjugated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

bFGF (FGF2) mouse monoclonal antibody, clone OTI3D9 (formerly 3D9)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated