Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-SLC18A1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SLC18A1 antibody: synthetic peptide directed towards the middle region of human SLC18A1. Synthetic peptide located within the following region: YYLRSPPAKEEKLAILSQDCPMETRMYATQKPTKEFPLGEDSDEEPDHEE

Anti-SLC18A1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 104-117 amino acids of human solute carrier family 18 (vesicular monoamine), member 1