Primary Antibodies

Jump to Filters
View as table Download
RPL18 Rabbit Polyclonal Antibody
TA335159

USD 375.00

5 Days

Rabbit polyclonal Anti-RPL18 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RPL18 antibody: synthetic peptide directed towards the N terminal of human RPL18. Synthetic peptide located within the following region: MGVDIRHNKDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKR