Primary Antibodies

Jump to Filters
View as table Download
RPL8 Rabbit Polyclonal Antibody
TA345688

USD 410.00

5 Days

Rabbit Polyclonal Anti-RPL8 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RPL8 antibody: synthetic peptide directed towards the C terminal of human RPL8. Synthetic peptide located within the following region: KKVISSANRAVVGVVAGGGRIDKPILKAGRAYHKYKAKRNCWPRVRGVAM
RPL8 Rabbit Polyclonal Antibody
TA345689

USD 410.00

5 Days

Rabbit Polyclonal Anti-RPL8 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RPL8 antibody: synthetic peptide directed towards the C terminal of human RPL8. Synthetic peptide located within the following region: EHPFGGGNHQHIGKPSTIRRDAPAGRKVGLIAARRTGRLRGTKTVQEKEN
RPL8 (181-195) Goat Polyclonal Antibody
AP22549PU-N

USD 440.00

2 Weeks

RPL8 (181-195) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Bat, Bovine, Canine, Chicken, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Xenopus, Zebrafish
Immunogen Synthetic peptide from an internal region of human RPL8