Primary Antibodies

Jump to Filters
View as table Download
U1A (SNRPA) Rabbit Polyclonal Antibody
TA345885

USD 475.00

5 Days

Rabbit Polyclonal Anti-SNRPA Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SNRPA antibody: synthetic peptide directed towards the middle region of human SNRPA. Synthetic peptide located within the following region: MPGQMPPAQPLSENPPNHILFLTNLPEETNELMLSMLFNQFPGFKEVRLV
U1A (SNRPA) Mouse Monoclonal Antibody [Clone ID: 3F9-1F7]
AM20942PU-N

USD 480.00

2 Weeks

U1A (SNRPA) mouse monoclonal antibody, clone 3F9-1F7

Applications ELISA, IF, IHC, WB
Reactivities Human