Primary Antibodies

Jump to Filters
View as table Download
WBP11 Rabbit Polyclonal Antibody
TA339335

USD 375.00

5 Days

Rabbit Polyclonal Anti-WBP11 Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-WBP11 antibody: synthetic peptide directed towards the N terminal of human WBP11. Synthetic peptide located within the following region: GRRSTSSTKSGKFMNPTDQARKEARKRELKKNKKQRMMVRAAVLKMKDPK