Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-ACAA1 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-ACAA1 antibody: synthetic peptide directed towards the N terminal of human ACAA1. Synthetic peptide located within the following region: ADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGD

Carrier-free (BSA/glycerol-free) ACAA1 mouse monoclonal antibody,clone OTI4F1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ACAA1 mouse monoclonal antibody,clone OTI4F1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ACAA1 mouse monoclonal antibody,clone OTI4F1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".