Primary Antibodies

Jump to Filters
View as table Download
FOXC1 Rabbit Polyclonal Antibody
TA335192

USD 375.00

5 Days

Rabbit Polyclonal Anti-FOXC1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXC1 antibody: synthetic peptide directed towards the N terminal of human FOXC1. Synthetic peptide located within the following region: GGYTAMPAPMSVYSHPAHAEQYPGGMARAYGPYTPQPQPKDMVKPPYSYI
FOXC1 Rabbit Polyclonal Antibody
TA376325

USD 220.00

3 Weeks

FOXC1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 404-553 of human FOXC1 (NP_001444.2).
Modifications Unmodified