Primary Antibodies

View as table Download

LOC100911951 mouse monoclonal antibody, clone K60/73

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

LOC100911951 mouse monoclonal antibody, clone K60/73

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-KCNIP2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNIP2 antibody: synthetic peptide directed towards the N terminal of human KCNIP2. Synthetic peptide located within the following region: QLTDSVDDEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYRGFKNPGALS