Primary Antibodies

Jump to Filters
View as table Download
HSD17B1 Rabbit Polyclonal Antibody
TA346185

USD 475.00

5 Days

Rabbit Polyclonal Anti-HSD17B1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-HSD17B1 antibody: synthetic peptide directed towards the N terminal of human HSD17B1. Synthetic peptide located within the following region: MARTVVLITGCSSGIGLHLAVRLASDPSQSFKVYATLRDLKTQGRLWEAA
HSD17B1 Rabbit Polyclonal Antibody
TA377232

USD 220.00

3 Weeks

HSD17B1 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-328 of human HSD17B1 (NP_000404.2).
Modifications Unmodified