Primary Antibodies

Jump to Filters
View as table Download
HOXA5 Rabbit Polyclonal Antibody
TA345267

USD 475.00

5 Days

Rabbit Polyclonal Anti-HOXA5 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-HOXA5 antibody: synthetic peptide directed towards the C terminal of human HOXA5. Synthetic peptide located within the following region: FNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKSMSMAAAG
HOXA5 Rabbit Polyclonal Antibody
TA371826

USD 380.00

4 Weeks

HOXA5 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human HOXA5
HOXA5 Rabbit Polyclonal Antibody
TA590480

USD 409.00

In Stock

Rabbit Polyclonal HOXA5 Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.
HOXA5 Rabbit Polyclonal Antibody
TA329289

USD 375.00

5 Days

Rabbit Polyclonal anti-HOXA5 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-HOXA5 antibody: synthetic peptide directed towards the middle region of human HOXA5. Synthetic peptide located within the following region: VGTASGAEEDAPASSEQASAQSEPSPAPPAQPQIYPWMRKLHISHDNIGG