Rabbit Polyclonal Anti-PSMD11 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PSMD11 Antibody: synthetic peptide directed towards the C terminal of human PSMD11. Synthetic peptide located within the following region: ALRYAGRQTEALKCVAQASKNRSLADFEKALTDYRAELRDDPIISTHLAK |
Rabbit Polyclonal Anti-PSMD11 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human PSMD11 |
PSMD11 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 253-422 of human PSMD11 (NP_002806.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
