Primary Antibodies

View as table Download

KLHL25 chicken polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen 14 amino acid peptide near the center of Human ENC-2.

Rabbit Polyclonal Anti-KLHL25 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KLHL25 antibody: synthetic peptide directed towards the N terminal of human KLHL25. Synthetic peptide located within the following region: RLYEFSWRMCLVHFETVRQSEDFNSLSKDTLLDLISSDELETEDERVVFE