Primary Antibodies

Jump to Filters
View as table Download
PSMA1 Rabbit Polyclonal Antibody
TA345809

USD 475.00

5 Days

Rabbit Polyclonal Anti-PSMA1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSMA1 antibody: synthetic peptide directed towards the C terminal of human PSMA1. Synthetic peptide located within the following region: TYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDL
PSMA1 Rabbit Polyclonal Antibody
TA365995

USD 380.00

4 Weeks

PSMA1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PSMA1
PSMA1 Rabbit Polyclonal Antibody
TA370346

USD 380.00

4 Weeks

PSMA1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PSMA1