Primary Antibodies

Jump to Filters
View as table Download
WDR5 Rabbit Polyclonal Antibody
TA345998

USD 475.00

5 Days

Rabbit Polyclonal Anti-WDR5 Antibody

Applications IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WDR5 antibody: synthetic peptide directed towards the C terminal of human WDR5. Synthetic peptide located within the following region: LAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGI