Primary Antibodies

Jump to Filters
View as table Download
DTX2 Rabbit Polyclonal Antibody
TA330457

USD 375.00

5 Days

Rabbit Polyclonal Anti-DTX2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DTX2 antibody: synthetic peptide directed towards the C terminal of human DTX2. Synthetic peptide located within the following region: EDCGTILIVYSIPHGIQGPEHPNPGKPFTARGFPRQCYLPDNAQGRKVLE
DTX2 Rabbit Polyclonal Antibody
TA375643

USD 220.00

3 Weeks

DTX2 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human DTX2 (NP_065943.2).
Modifications Unmodified