Primary Antibodies

View as table Download

Goat Anti-EBF1 / COE1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-HNQLPALANTSV, from the internal region of the protein sequence according to NP_076870.1.

Rabbit Polyclonal Anti-EBF1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EBF1 antibody: synthetic peptide directed towards (50ug) human EBF1.. Synthetic peptide located within the following region: LPSNCSSSSGIFSFSPANMVSAVKQKSAFAPVVRPQTSPPPTCTSTNGNS

Rabbit Polyclonal anti-EBF1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EBF1 antibody: synthetic peptide directed towards the N terminal of human EBF1. Synthetic peptide located within the following region: MCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCL

EBF1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 500 to the C-terminus of human EBF1 (NP_076870.1).
Modifications Unmodified

EBF1 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 500 to the C-terminus of human EBF1 (NP_076870.1).
Modifications Unmodified