Primary Antibodies

View as table Download

Rabbit polyclonal antibody to RED (RED cytokine, down-regulator of HLA II)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1 and 45 of RED (Uniprot ID#Q13123)

Rabbit Polyclonal Anti-Ik

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Ik antibody is: synthetic peptide directed towards the C-terminal region of Mouse Ik. Synthetic peptide located within the following region: GIKMSEGRKTRRFKETNDKAELDRQWKKISAIIEKRKRMEADGVEVKRPK

Rabbit polyclonal anti-RED antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RED.

IK Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human IK (NP_006074.2).
Modifications Unmodified