Thyroid Peroxidase (TPO) mouse monoclonal antibody, clone TPO28
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Thyroid Peroxidase (TPO) mouse monoclonal antibody, clone TPO28
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Thyroid Peroxidase (TPO) mouse monoclonal antibody, clone TPO34
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Goat Polyclonal Antibody against thyroid peroxidase
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-TRHVIQVSNEVVTDD, from the internal region of the protein sequence according to NP_000538.3; NP_783650.1; NP_783652.1; NP_783653.1. |
Rabbit Polyclonal Anti-TPO Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TPO antibody is: synthetic peptide directed towards the N-terminal region of Human TPO. Synthetic peptide located within the following region: GASNTALARWLPPVYEDGFSQPRGWNPGFLYNGFPLPPVREVTRHVIQVS |
TPO Antibody - C-terminal region (ARP44312_P050)
Applications | WB |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human TPO |