Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-LMX1B Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LMX1B Antibody: A synthesized peptide derived from human LMX1B |
Primary Antibodies
View as table Download
Rabbit polyclonal anti-LMX1B antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human LMX1B. |
LMX1B rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
Rabbit polyclonal anti-LMX1B antibody (CT)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Rabbit polyclonal LMX1B antibody was raised against a 17 amino acid peptide near the carboxy terminus of human LMX1B. |
Rabbit Polyclonal Anti-LMX1B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-LMX1B Antibody: synthetic peptide directed towards the C terminal of human LMX1B. Synthetic peptide located within the following region: QSPYGSSDPFQQGLTPPQMPGNDSIFHDIDSDTSLTSLSDCFLGSSDVGS |
LMX1B Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human LMX1B (NP_001167618.1). |
| Modifications | Unmodified |
LMX1B Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human LMX1B (NP_001167618.1). |
| Modifications | Unmodified |
LMX1B Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 136-395 of human LMX1B (NP_002307.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- LMX1B
Applications
- WB
Clonalities
- Polyclonal