Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-NNMT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NNMT antibody: synthetic peptide directed towards the N terminal of human NNMT. Synthetic peptide located within the following region: MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFC

Rabbit Polyclonal Antibody against NNMT (Center)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This NNMT antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 77-106 amino acids from the Central region of human NNMT.

Goat Anti-NNMT Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence TSKDTYLSHFNP-C, from the N Terminus of the protein sequence according to NP_006160.1.

Goat Anti-NNMT (aa171-182) Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence PDLPTYCRALRN, from the internal region of the protein sequence according to NP_006160.1.

NNMT Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-264 of human NNMT (NP_006160.1).
Modifications Unmodified

NNMT Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-264 of human NNMT (NP_006160.1).
Modifications Unmodified

NNMT Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-264 of human NNMT (NP_006160.1).
Modifications Unmodified