Primary Antibodies

Jump to Filters
View as table Download
PIGQ Rabbit Polyclonal Antibody
TA339399

USD 375.00

5 Days

Rabbit Polyclonal Anti-PIGQ Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PIGQ antibody: synthetic peptide directed towards the N terminal of human PIGQ. Synthetic peptide located within the following region: PTVLPDRQAGATTASTGGLAAVFDTVARSEVLFRSDRFDEGPVRLSHWQS
PIGQ Rabbit Polyclonal Antibody
TA379919

USD 220.00

3 Weeks

PIGQ Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human PIGQ (NP_683721.1).