Primary Antibodies

Jump to Filters
View as table Download
Calcineurin B (PPP3R1) Rabbit Polyclonal Antibody
TA335156

USD 375.00

5 Days

Rabbit polyclonal Anti-PPP3R1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP3R1 antibody: synthetic peptide directed towards the N terminal of human PPP3R1. Synthetic peptide located within the following region: MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQ
Calcineurin B (PPP3R1) Rabbit Polyclonal Antibody
TA380270

USD 220.00

3 Weeks

PPP3R1 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 11-170 of human PPP3R1 (NP_000936.1).
Modifications Unmodified