Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-RAPGEF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RAPGEF1 antibody: synthetic peptide directed towards the C terminal of human RAPGEF1. Synthetic peptide located within the following region: LWAKEQNEEKSPNLTQFTEHFNNMSYWVRSIIMLQEKAQDRERLLLKFIK

RAPGEF1 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 844-1095 of human RAPGEF1 (NP_941372.1).
Modifications Unmodified