Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-UBA3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UBA3 antibody: synthetic peptide directed towards the N terminal of human UBA3. Synthetic peptide located within the following region: EGRWNHVKKFLERSGPFTHPDFEPSTESLQFLLDTCKVLVIGAGGLGCEL

UBA3 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 234-463 of human UBA3 (NP_003959.3).
Modifications Unmodified