Primary Antibodies

Jump to Filters
View as table Download
Claudin 5 (CLDN5) Rabbit Polyclonal Antibody
TA347354

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-Claudin 5 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Claudin 5 Antibody: A synthesized peptide derived from human Claudin 5
Claudin 5 (CLDN5) Rabbit Polyclonal Antibody
TA312091

USD 345.00

4 Weeks

Rabbit polyclonal anti-Claudin 5 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human CLDN5.
Claudin 5 (CLDN5) Rabbit Polyclonal Antibody
TA347919

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-Claudin 5 Antibody

Applications WB
Reactivities Human, Mouse, Rat, Pig, Cow
Conjugation Unconjugated
Immunogen The immunogen for anti-Claudin 5 Antibody: A synthesized peptide derived from human Claudin 5
Claudin 5 (CLDN5) Rabbit Polyclonal Antibody
TA334202

USD 375.00

5 Days

Rabbit Polyclonal Anti-CLDN5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLDN5 antibody: synthetic peptide directed towards the C terminal of human CLDN5. Synthetic peptide located within the following region: GWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATGDYDKKN