Germany
Japan
United Kingdom
China
Rabbit polyclonal antibody to GPR4 (G protein-coupled receptor 4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 159 and 254 of GPR4 (Uniprot ID#P46093) |
Primary Antibodies
View as table Download
Rabbit polyclonal GPR4 Antibody (Center)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | This GPR4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 196-224 amino acids from the Central region of human GPR4. |
Rabbit Polyclonal Anti-Gpr4 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Gpr4 antibody is: synthetic peptide directed towards the middle region of Mouse Gpr4. Synthetic peptide located within the following region: LCYRGILRAVQSSVSTERQEKVKIKRLALSLIAIVLVCFAPYHALLLSRS |
Active filters
Target Symbol
- GPR4
Applications
- WB
Conjugates
- Unconjugated