5HT7 Receptor (HTR7) (8-23) rabbit polyclonal antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
5HT7 Receptor (HTR7) (8-23) rabbit polyclonal antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
5HT7 Receptor (HTR7) rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Goat Anti-HTR7 / 5-HT7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence QNADYCRKKGHDS, from the C Terminus of the protein sequence according to NP_000863.1. |
Rabbit Polyclonal Anti-HTR7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HTR7 antibody: synthetic peptide directed towards the N terminal of human HTR7. Synthetic peptide located within the following region: HLLSEVTASPAPTWDAPPDNASGCGEQINYGRVEKVVIGSILTLITLLTI |
Rabbit Polyclonal Anti-HTR7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HTR7 antibody: synthetic peptide directed towards the N terminal of human HTR7. Synthetic peptide located within the following region: HLLSEVTASPAPTWDAPPDNASGCGEQINYGRVEKVVIGSILTLITLLTI |
Rabbit Polyclonal 5-HT7 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Canine |
Conjugation | Unconjugated |
Immunogen | This antibody was developed by immunizing rabbits with a mixture of synthetic peptides corresponding to amino acids 13-28 of the rat 5-HT7R (AAA42134.1). |