Primary Antibodies

View as table Download

Rabbit Polyclonal antibody to MP1 (MAPK scaffold protein 1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 124 of MP1 (Uniprot ID#Q9UHA4)

Rabbit Polyclonal MAP2K1IP1/MAPKSP1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A genomic peptide made to an internal region of the human MAP2K1IP1 protein (within residues 20-180). [Swiss-Prot Q9UHA4]

Rabbit Polyclonal Anti-LAMTOR3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LAMTOR3 antibody is: synthetic peptide directed towards the N-terminal region of Human LAMTOR3. Synthetic peptide located within the following region: LPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSK