Primary Antibodies

Jump to Filters
View as table Download
Microsomal Glutathione S transferase 1 (MGST1) Rabbit Polyclonal Antibody
TA314192

USD 345.00

In Stock

Rabbit polyclonal anti-MGST1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MGST1.
Microsomal Glutathione S transferase 1 (MGST1) Rabbit Polyclonal Antibody
TA342917

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-MGST1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MGST1 antibody: synthetic peptide directed towards the N terminal of human MGST1. Synthetic peptide located within the following region: NPEDCVAFGKGENAKKYLRTDDRVERVRRAHLNDLENIIPFLGIGLLYSL
Mgst1 Mouse Monoclonal Antibody [Clone ID: P1A12]
TA328084

USD 165.00

5 Days

Mouse Monoclonal anti-GST Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Microsomal Glutathione S transferase 1 (MGST1) Rabbit Polyclonal Antibody
TA354318

USD 355.00

5 Days

Rabbit anti GST Polyclonal Antibody

Applications WB
Conjugation Unconjugated
Immunogen A full length of GST recombinant protein.
Microsomal Glutathione S transferase 1 (MGST1) Rabbit Polyclonal Antibody
TA378516

USD 220.00

3 Weeks

MGST1 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MGST1 (NP_001247440.1).
Modifications Unmodified