Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-PSMD11 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PSMD11 Antibody: synthetic peptide directed towards the C terminal of human PSMD11. Synthetic peptide located within the following region: ALRYAGRQTEALKCVAQASKNRSLADFEKALTDYRAELRDDPIISTHLAK

Rabbit Polyclonal Anti-PSMD11 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PSMD11

Rabbit polyclonal anti-PSMD11 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PSMD11.

Rabbit Polyclonal Anti-PSMD11 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSMD11 antibody: synthetic peptide directed towards the N terminal of human PSMD11. Synthetic peptide located within the following region: MAAAAVVEFQRAQSLLSTDREASIDILHSIVKRDIQENDEEAVQVKEQSI

Rabbit Polyclonal Anti-PSMD11 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSMD11 antibody: synthetic peptide directed towards the N terminal of human PSMD11. Synthetic peptide located within the following region: MAAAAVVEFQRAQSLLSTDREASIDILHSIVKRDIQENDEEAVQVKEQSI

PSMD11 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 253-422 of human PSMD11 (NP_002806.2).
Modifications Unmodified