Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-SKI2W Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen SKI2W antibody was raised against a 16 amino acid peptide near the amino terminus of human SKI2W.

Rabbit Polyclonal Anti-SHBG Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen SHBG antibody was raised against a 16 amino acid peptide near the center of human SHBG.

Rabbit Polyclonal Anti-SHBG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SHBG antibody is: synthetic peptide directed towards the C-terminal region of SHBG. Synthetic peptide located within the following region: RGEDSSTSFCLNGLWAQGQRLDVDQALNRSHEIWTHSCPQSPGNGTDASH

Rabbit Polyclonal Anti-SHBG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SHBG antibody is: synthetic peptide directed towards the N-terminal region of Human SHBG. Synthetic peptide located within the following region: FDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLH

Carrier-free (BSA/glycerol-free) SHBG mouse monoclonal antibody, clone OTI1D10 (formerly 1D10)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SHBG mouse monoclonal antibody, clone OTI1A6 (formerly 1A6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SHBG mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

SHBG Antibody - middle region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse SHBG

SHBG Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 30-170 of human SHBG (NP_001031.2).
Modifications Unmodified

SHBG mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

SHBG mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated