Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-SLC4A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SLC4A1 antibody: synthetic peptide directed towards the N terminal of human SLC4A1. Synthetic peptide located within the following region: PSQPLLPQHSSLETQLFCEQGDGGTEGHSPSGILEKIPPDSEATLVLVGR

SLC4A1 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-353 of human SLC4A1 (NP_000333.1).