Rabbit polyclonal SSTR1 antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SSTR1. |
Rabbit polyclonal SSTR1 antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SSTR1. |
Somatostatin Receptor 1 (SSTR1) rabbit polyclonal antibody
Applications | IF, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-SSTR1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SSTR1 antibody: synthetic peptide directed towards the C terminal of human SSTR1. Synthetic peptide located within the following region: RMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAEQD |
Rabbit Polyclonal Somatostatin Receptor 1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Raised against a synthetic peptide from the c-terminus of rat SSR1 receptor conjugated to cysteine. |
Rabbit polyclonal Anti-Somatostatin Receptor Type I (extracellular)
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | Peptide CSRGPGSGAADGMEE, corresponding to amino acid? residues 26-40 of rat somatostatin receptor type 1 (Accession# P28646). Extracellular, N-terminus. |
Rabbit Polyclonal Anti-SSTR1 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Sstr1 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Sstr1. Synthetic peptide located within the following region: QRILCLSWMDNAAEEPVDYYATALKSRAYSVEDFQPENLESGGVFRNGTC |
Anti-SSTR1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 370-384 amino acids of human somatostatin receptor 1 |
SSTR1 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SSTR1 |
SSTR1 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 292-391 of human SSTR1 (NP_001040.1). |
Modifications | Unmodified |