Primary Antibodies

View as table Download

Rabbit Polyclonal GITRL Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen GITRL antibody was raised against purified recombinant human GITR ligand.

Rabbit Polyclonal Anti-TNFSF18 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TNFSF18 antibody: synthetic peptide directed towards the middle region of human TNFSF18. Synthetic peptide located within the following region: KLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQN