Primary Antibodies

Jump to Filters
View as table Download
TMPRSS11E (Center) Rabbit Polyclonal Antibody
AP54297PU-N

USD 450.00

2 Weeks

TMPRSS11E (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 248-277 amino acids from the Central region of human TMPRSS11E
TMPRSS11E Rabbit Polyclonal Antibody
TA330794

USD 375.00

5 Days

Rabbit Polyclonal Anti-TMPRSS11E Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TMPRSS11E antibody is: synthetic peptide directed towards the N-terminal region of Human TMPRSS11E. Synthetic peptide located within the following region: CIGLTVHYVRYNQKKTYNYYSTLSFTTDKLYAEFGREASNNFTEMSQRLE