Primary Antibodies

View as table Download

Rabbit Polyclonal SOX11 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A partial recombinant portion of human SOX11 (between residues 50-300) [UniProt P35716]

Goat Anti-SOX11 (aa309-323) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-SRLYYSFKNITKQHP, from the internal region of the protein sequence according to NP_003099.1.

Rabbit Polyclonal Anti-SOX11 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SOX11 Antibody: synthetic peptide directed towards the N terminal of human SOX11. Synthetic peptide located within the following region: MVQQAESLEAESNLPREALDTEEGEFMACSPVALDESDPDWCKTASGHIK

Rabbit Polyclonal Anti-SOX11 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SOX11 Antibody: synthetic peptide directed towards the middle region of human SOX11. Synthetic peptide located within the following region: PHQQLLQPPGQQPSQLLRRYNVAKVPASPTLSSSAESPEGASLYDEVRAG

Rabbit Polyclonal Anti-SOX11 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SOX11 Antibody: synthetic peptide directed towards the N terminal of human SOX11. Synthetic peptide located within the following region: MVQQAESLEAESNLPREALDTEEGEFMACSPVALDESDPDWCKTASGHIK

Rabbit Polyclonal Anti-SOX11 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SOX11