KCNV2 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 477-507 amino acids from the C-terminal region of human KCNV2 |
KCNV2 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 477-507 amino acids from the C-terminal region of human KCNV2 |
Rabbit polyclonal anti-OR4K3 antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human OR4K3. |
Rabbit Polyclonal Anti-KCNV2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KCNV2 antibody: synthetic peptide directed towards the N terminal of human KCNV2. Synthetic peptide located within the following region: RSGSQASIHGWTEGNYNYYIEEDEDGEEEDQWKDDLAEEDQQAGEVTTAK |