Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-UCHL3 Antibody - N-terminal region

Applications IHC, WB
Reactivities Human, Zebrafish
Conjugation Unconjugated
Immunogen The immunogen for anti-UCHL3 antibody: synthetic peptide directed towards the N terminal of human UCHL3. Synthetic peptide located within the following region: MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVC

Rabbit Polyclonal Anti-UCHL5 Antibody - middle region

Applications WB
Reactivities Human, Zebrafish
Conjugation Unconjugated
Immunogen The immunogen for anti-UCHL5 antibody: synthetic peptide directed towards the middle region of human UCHL5. Synthetic peptide located within the following region: DGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRK

Rabbit polyclonal antibody to PSMB8 (proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7))

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 52 and 276 of PSMB8 (Uniprot ID#P28062)

Rabbit Polyclonal ZMPSTE24 Antibody

Applications WB
Reactivities Human, Mouse, Primate, Zebrafish
Conjugation Unconjugated
Immunogen A synthetic peptide made to an N-terminal portion of the human ZMPSTE24 protein sequence (between residues 1-100). [Swiss-Prot O75844]

Rabbit polyclonal anti-ATG4B antibody (Center)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ATG4B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 250-290 amino acids from the Central region of human ATG4B.

BAP1 Antibody - C-terminal region

Applications WB
Reactivities Zebrafish
Conjugation Unconjugated