Primary Antibodies

Jump to Filters
View as table Download
NOLC1 Rabbit Polyclonal Antibody
TA314879

USD 345.00

In Stock

Rabbit polyclonal anti-NOLC1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human NOLC1.
NOLC1 Rabbit Polyclonal Antibody
TA339273

USD 310.00

5 Days

Rabbit Polyclonal Anti-NOLC1 Antibody

Applications IHC, WB
Reactivities Human, Zebrafish
Conjugation Unconjugated
Immunogen The immunogen for anti-NOLC1 antibody: synthetic peptide directed towards the C terminal of human NOLC1. Synthetic peptide located within the following region: DNSFDAKRGAAGDWGERANQVLKFTKGKSFRHEKTKKKRGSYRGGSISVQ