Rabbit polyclonal anti-NOLC1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human NOLC1. |
Rabbit polyclonal anti-NOLC1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human NOLC1. |
Rabbit Polyclonal Anti-NOLC1 Antibody
Applications | IHC, WB |
Reactivities | Human, Zebrafish |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NOLC1 antibody: synthetic peptide directed towards the C terminal of human NOLC1. Synthetic peptide located within the following region: DNSFDAKRGAAGDWGERANQVLKFTKGKSFRHEKTKKKRGSYRGGSISVQ |