Primary Antibodies

Jump to Filters
View as table Download
SLC7A2 Rabbit Polyclonal Antibody
TA334148

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-SLC7A2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC7A2 Antibody: synthetic peptide directed towards the middle region of human SLC7A2. Synthetic peptide located within the following region: VANWKISEEFLKNISASAREPPSENGTSIYGAGGFMPYGFTGTLAGAATC