Rabbit polyclonal antibody to CDC37L1 (cell division cycle 37 homolog (S. cerevisiae)-like 1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 275 and 337 of CDC37L1 (Uniprot ID#Q7L3B6) |
Rabbit Polyclonal Anti-CDC37L1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDC37L1 antibody is: synthetic peptide directed towards the N-terminal region of Human CDC37L1. Synthetic peptide located within the following region: AEGEAEEESDFDVFPSSPRCPQLPGGGAQMYSHGIELACQKQKEFVKSSV |
CDC37L1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 2-240 of human CDC37L1 (NP_060383.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China