Rabbit Polyclonal Anti-CHRM1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CHRM1 |
Rabbit Polyclonal Anti-CHRM1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CHRM1 |
Rabbit anti-CHRM1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CHRM1 |
Goat Polyclonal Antibody against Cholinergic receptor / CHRM1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-DKRRWRKIPKRPGSVH, from the C Terminus of the protein sequence according to NP_000729.2. |
Rabbit polyclonal anti-CHRM1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CHRM1. |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-CHRM1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CHRM1 antibody is: synthetic peptide directed towards the C-terminal region of Human CHRM1. Synthetic peptide located within the following region: VKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKEKKAARTLSAILLAFI |
CHRM1 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 400 to the C-terminus of human CHRM1 (NP_000729.2). |
Modifications | Unmodified |
CHRM1 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human CHRM1. |