Rabbit polyclonal anti-PAR4 antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PAR4. |
Rabbit polyclonal anti-PAR4 antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PAR4. |
Rabbit polyclonal PAR4 (Cleaved-Gly48) antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human PAR4. |
Rabbit Polyclonal Anti-F2RL3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-F2RL3 Antibody is: synthetic peptide directed towards the C-terminal region of Human F2RL3. Synthetic peptide located within the following region: LNSCVDPFIYYYVSAEFRDKVRAGLFQRSPGDTVASKASAEGGSRGMGTH |
F2RL3 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 20-150 of human F2RL3 (NP_003941.2). |
Modifications | Unmodified |