Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-FBXO11 Antibody

Applications Assay, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FBXO11 antibody: synthetic peptide directed towards the middle region of human FBXO11. Synthetic peptide located within the following region: HDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDTDTLYDSAPPIESNTLQ

FBXO11 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 688-927 of human FBXO11 (NP_001177203.1).
Modifications Unmodified