Rabbit Polyclonal antibody to MP1 (MAPK scaffold protein 1)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 124 of MP1 (Uniprot ID#Q9UHA4) |
Rabbit Polyclonal antibody to MP1 (MAPK scaffold protein 1)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 124 of MP1 (Uniprot ID#Q9UHA4) |
Rabbit Polyclonal Anti-LAMTOR3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LAMTOR3 antibody is: synthetic peptide directed towards the N-terminal region of Human LAMTOR3. Synthetic peptide located within the following region: LPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSK |