Primary Antibodies

Jump to Filters
View as table Download
MAP2K1IP1 (LAMTOR3) Rabbit Polyclonal Antibody
TA308268

USD 415.00

5 Days

Rabbit Polyclonal antibody to MP1 (MAPK scaffold protein 1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 124 of MP1 (Uniprot ID#Q9UHA4)
MAP2K1IP1 (LAMTOR3) Rabbit Polyclonal Antibody
TA342911

USD 375.00

5 Days

Rabbit Polyclonal Anti-LAMTOR3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LAMTOR3 antibody is: synthetic peptide directed towards the N-terminal region of Human LAMTOR3. Synthetic peptide located within the following region: LPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSK